Vítejte na webu Toxicology - Prof. RNDr. Jiří Patočka, DrSc
Přihlásit se nebo Registrovat Domů  ·  Prof. Patočka  ·  Student ART  ·  Student RA  ·  Student KRT  ·  Doktorand  ·  Fórum  

  Moduly
· Domů
· Archív článků
· Doporučit nás
· Články na internetu
· Fotogalerie
· Poslat článek
· Průzkumy
· Připomínky
· Soubory
· Soukromé zprávy
· Statistiky
· Témata
· Top 10
· Váš účet
· Verze pro PDA
· Vyhledávání

  Skupiny uživatelů
· Prof. Patočka
· Student ART
· Student RA
· Student KRT
· Doktorand

  Kdo je online
V tuto chvíli je 59392 návštěvník(ů) a 0 uživatel(ů) online.

Jste anonymní uživatel. Můžete se zdarma zaregistrovat zde


  Články vlastní: Jihoamerická rosnička imbabura a její bioaktivní peptidy
Publikováno: Středa, 07.09. 2022 - 09:06:23 Od: Prof. Patocka
prof Patočka

Jihoamerická rosnička imbabura a její bioaktivní peptidy

Jiří Patočka

     Rosnička imbabura (Boana picturata) je druh žáby z čeledi Hylidae vyskytující se v tichomořských nížinách západní Kolumbie a severozápadního Ekvádoru. Přirozeným prostředím tohoto vzácného druhu žáby jsou vlhké tropické lesy. Žije na stromech v blízkosti potoků. Je to nápadně barevná žába s proměnlivým zbarvením a vzorováním. Hřbet je fialovo-hnědý s krémově zbarvenými skvrnami ohraničenými purpurově červenými okraji, ale kresba i barvy jsou velmi individuální. Má širokou hlavu s velkýma vyboulenýma a daleko od sebe posazenýma očima, mezi nimiž probíhá bílý příčný pás, uprostřed přerušený. Spodní část těla je bílá. Samci měří 46–53 mm a samice 62–69 mm (Boulenger 1899).



     Rosnička Imbabura je dosud málo prozkoumaným zdrojem bioaktivních peptidů. Kombinace molekulárního klonování a hmotnostní spektrometrie však umožnila nedávno identifikovat v její kůži tři nové rodiny peptidů, které byly souhrnně nazvány picturiny, pictuseptiny a boaniny (Morán-Marcillo et al., 2022). Teprve jejich další výzkum však ukáže, k čemu jsou tyto informace dobré.
Picturiny (picturin-1, -2 a -3) jsou lineární peptidy o 25 aminokyselinách, jejichž N-koncová sekvence aminokyselin je GVFKDALKQ a C-koncová sekvence AANALKPK:
Picturin-1: GVFKDALKQLGAALLDKAANALKPK 
Picturin-2: GVFKDALKQFGAALLDKAANALKPK
Picturin-3: GVFKDALKQFGAALLDQAANALKPK 
Pictuseptiny tvoří skupinu šesti lineálních peptidů o 22 (pictuseptin-1, -2 a -4) a 26 aminokyselinách (pictuseptin-3, -5, a -6)
Pictuseptin-1: GFLDTLNKNIGKTVGRIALNVLT
Pictuseptin-2: GFLDTLKNIGKTVGGIALNVLT 
Pictuseptin-3: GFLDTLKNIGKTVGKVALDVAKNVLT
Pictuseptin-4: GFLDTLKNIGKAVGRVALNVLT
Pictuseptin-5: GFLDALKNIGKTVGKVALDVAKNVLTG
Pictuseptin-6: GFLDTLKNIGKTVGKVALDVAKNVSTG
Boaniny (boanin-1, -2, -3, a -4) jsou lineární peptidy vykazující vysokou (70 – 83 %) identitu s figaininy a  raniseptiny.
Boanin-1: FLGALFTIGKAIGKAILPLAVKALNPGQWFISKEHNY
Boanin-2: FLGALFTIGKAIGKAILPLAVKALNPGH
Boanin-3: FLGALFAIGKAIGKAILPLAVKAFNPGH
Boanin-4: FLGALFTIGKAIGKAILPLAVKAFNPGH
O biologických účincích peptidů rosničky Boana picturata se ví pouze to, že vykazují antibakteriální účinnost (např. nejaktivnějším peptidem proti E. coli (6,8 µM) je pictuseptin-1, následovaný pictuseptinem-3 (11,7 µM) a pictuseptinem-2 (14,24 µM). Peptidy této žáby také vykazují slabou hemolytickou aktivitu (Morán-Marcillo et al., 2022).
Literatura
Boulenger GA. Descriptions of new batrachians in the collection of the British Museum (Natural History). Annals and Magazine of Natural History, 1899; 7(3):  273-277.
Morán-Marcillo G, Hinojosa VS, de Los Monteros-Silva NE, Blasco-Zúñiga A, Rivera M, Naranjo RE, Almeida JR, Wang L, Zhou M, ChenT, Shaw C, Proaño-Bolaños C. Picturins and Pictuseptins, two novel antimicrobial peptide families from the skin secretions of the Chachi treefrog, Boana picturata. J Proteomics, 2022; 104633.
 
 
  Přihlásit se
Přezdívka

Heslo

Ještě nemáte svůj účet? Můžete si jej vytvořit zde. Jako registrovaný uživatel získáte řadu výhod. Budete moct upravit vzhled tohoto webu, nastavit zobrazení komentářů, posílat komentáře, posílat zprávy ostatním uživatelům a řadu dalších.

  Související odkazy
· Více o tématu prof Patočka
· Další články od autora Prof. Patocka


Nejčtenější článek na téma prof Patočka:
Kyselina fytová a naše zdraví


  Hodnocení článku
Průměrné hodnocení: 5
Účastníků: 7

Výborný

Zvolte počet hvězdiček:

Výborný
Velmi dobré
Dobré
Povedený
Špatné


  Možnosti

 Vytisknout článek Vytisknout článek

 Poslat článek Poslat článek

Související témata

prof Patočka





Odebírat naše zprávy můžete pomocí souboru backend.php nebo ultramode.txt.
Powered by Copyright © UNITED-NUKE, modified by Prof. Patočka. Všechna práva vyhrazena.
Čas potřebný ke zpracování stránky: 0.06 sekund

Hosting: SpeedWeb.cz

Administrace